Protein Info for Shew_0596 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 287 to 308 (22 residues), see Phobius details PF02743: dCache_1" amino acids 42 to 271 (230 residues), 64.2 bits, see alignment E=2.8e-21 PF17201: Cache_3-Cache_2" amino acids 185 to 285 (101 residues), 38.8 bits, see alignment E=1.4e-13 PF00672: HAMP" amino acids 306 to 358 (53 residues), 36.8 bits, see alignment 7.9e-13 PF00015: MCPsignal" amino acids 423 to 606 (184 residues), 137.6 bits, see alignment E=7.9e-44

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to slo:Shew_0596)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAH0 at UniProt or InterPro

Protein Sequence (640 amino acids)

>Shew_0596 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella loihica PV-4)
MLKLNIRRKVVLATLASVVLSIFLISLYAMSNSREIILDSTLNRELPAVLGEVANDIDAQ
LLMPITVSKVMANNLEYQAMIRQGEPEASQATLIASLANIRQRFGAITAFLVSNTTGRYF
THEGLFKTVSPSDDRDAWFYRFLGSGKDYDLSIDVDDLNQTPTLFINYLVQIEGKPSGVA
GVGLSLNSLADNIKQYKIGEQGRVYLTDGNGQIKIHGQSQFAGKQLSALGIKDPQALLSQ
QTFATSEYDNNGVDTLVASRYIPSIGWYLIAEVPQDELFGAINKASWQLALMGLILAAII
MFTSAWLINRLISPFGELADMLKSIGEGEGDLSLRLDDSRQDETGSMAASYNQFVTYLSK
TLQSVSATANDLFQAVERIDNQAKHMEHEINDQVSKIEQVATAIHEMGMTAQEIASSANN
AAENAQVADQSVNQGNQSVQNTIASVASMSEQLLTTSETVSQLAEDASSIDTVLEVIRGV
SEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLASRSHASTEDIRHIIEKLQAKTTEV
VNAIGQSTNQSQQSQQEASLSGEHLHSIAENIQAMSEMSMQIATATEEQSNVVGEINPHV
TAIADISRSSSDVVRQTSLDCSDLREMAVQLNELVSRFKF