Protein Info for Shew_0585 in Shewanella loihica PV-4

Annotation: cAMP-regulatory protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00027: cNMP_binding" amino acids 23 to 109 (87 residues), 79.5 bits, see alignment E=2.3e-26 PF13545: HTH_Crp_2" amino acids 143 to 206 (64 residues), 50.4 bits, see alignment E=2.7e-17 PF00325: Crp" amino acids 167 to 198 (32 residues), 40 bits, see alignment 3.8e-14

Best Hits

Swiss-Prot: 88% identical to CRP_SALTY: cAMP-activated global transcriptional regulator CRP (crp) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 97% identity to svo:SVI_0504)

Predicted SEED Role

"Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAF9 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Shew_0585 cAMP-regulatory protein (RefSeq) (Shewanella loihica PV-4)
MALIGKPKPDPTLEWFLSHCHIHKYPAKSTLIHAGEDSDTLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEQAERTAWVRAKQACEIAEISYKKFKQLIQVNPEILMKLSS
QMAYRLQSTSQKVGDLAFLDVAGRIAQTLLHLAKQPDAMTHPDGMQIKITRQEIGQIVGC
SRETVGRILKMLEEQNLIQAHGKTIVVYGTR