Protein Info for Shew_0574 in Shewanella loihica PV-4

Annotation: ClpXP protease specificity-enhancing factor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF04386: SspB" amino acids 7 to 152 (146 residues), 145 bits, see alignment E=1e-46

Best Hits

KEGG orthology group: K03600, stringent starvation protein B (inferred from 100% identity to slo:Shew_0574)

Predicted SEED Role

"Stringent starvation protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAE8 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Shew_0574 ClpXP protease specificity-enhancing factor (RefSeq) (Shewanella loihica PV-4)
MKPMTPNRPYLLQAYYDWLMDNELTPHVVVDAYVPGTQVPQQYVKDGQIVLNITASAVGN
LQIGHDFIEFNARFGGVPQQVVLPMASIVAIYARENGAGTVFDQEEAYQLEADARDLGLS
VVDEPKTDEPAVAEASAENDKPKRRGHLTLVK