Protein Info for Shew_0556 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details PF00892: EamA" amino acids 10 to 139 (130 residues), 57.4 bits, see alignment E=1e-19 amino acids 151 to 278 (128 residues), 51.7 bits, see alignment E=5.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0556)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAD0 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Shew_0556 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MNTSSSERSGLIELHLAVLLFGGTALFSKLIPLSALDITALRCCIAALALALLVKVSGKH
LRLNRGKDYGIALGLGIIVSLHWVTYFAAMQLSSVAIGMIAFFTYPVMTVLVEPFFTGKR
LELADIISGICVLLGVSLLIPEANLGNDVTLGIIIGVLSAALFTARNLLHKRYFASYSGA
QAMYYQTGVSALFLLPWLEVDPSAIQANVWWLVILLGIVFTAAPHALFTSALRQLSAKTV
SLVSCLQPLYGALLALLILGEGLAMKTLIGGALVVFTAVYETQKSHKANRAQKAKS