Protein Info for Shew_0530 in Shewanella loihica PV-4

Annotation: FAD dependent oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01266: DAO" amino acids 5 to 369 (365 residues), 194.9 bits, see alignment E=3.1e-61 PF13450: NAD_binding_8" amino acids 8 to 47 (40 residues), 24.3 bits, see alignment 3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0530)

Predicted SEED Role

"Aminobutyraldehyde dehydrogenase (EC 1.2.1.19)" (EC 1.2.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAA4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Shew_0530 FAD dependent oxidoreductase (RefSeq) (Shewanella loihica PV-4)
MDKLDAIVIGAGVVGLAVAASLSRRFGNVLIIDRAETIGTGISSRNSEVIHAGIYYPTGS
LKAQLCVEGKRQLYAYCRRRGVAVNSLGKLIVATQVEQEAQLDALFTQARANGVDDLNPL
GRRQLQALEPALKASAGLLSPSTGIVDSHGLMLSLLAEAEEYGAIFCPHTEFITTQADAN
GFRVELMQQGERVSLETSFLINCAGLFATEVATRIEGLAESLVPQLYWCKGHYFAYQGKS
PFAHLIYPVPEPGLKGLGIHATIDLGGQLKFGPDAQYMVPDSLEDYRVPEALRQRFHQAI
ASYYPGIAIERLQTAYAGIRPKLQGPDDTEVADFLIQGEAQHGIPGLVNLLGIESPGLTA
SLAIAEQVSRQLVTP