Protein Info for Shew_0522 in Shewanella loihica PV-4

Name: metF
Annotation: 5,10-methylenetetrahydrofolate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02219: MTHFR
  • amino acids 17 to 291 (275 residues), 346 bits, E=9.2e-108
• TIGR00676: methylenetetrahydrofolate reductase [NAD(P)H]
  • amino acids 25 to 290 (266 residues), 340.7 bits, E=3.2e-106

Best Hits

Swiss-Prot: 74% identical to METF_SHIFL: 5,10-methylenetetrahydrofolate reductase (metF) from Shigella flexneri

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 100% identity to slo:Shew_0522)

MetaCyc: 74% identical to 5,10-methylenetetrahydrofolate reductase (Escherichia coli K-12 substr. MG1655)
RXN-22438 [EC: 1.5.1.54]

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

• folate transformations II (plants) (11/11 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate transformations I (10/13 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (4/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.20 or 1.5.1.54

Sequence Analysis Tools

See A3QA96 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Shew_0522 5,10-methylenetetrahydrofolate reductase (RefSeq) (Shewanella loihica PV-4)
MAFHHAQHANSLNQSLSELNGDINVSFEFFPPATPEMETILWNSIRRLEPLKPKFVSVTY
GANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELVELAKHYWNSGIRDIVALRGD
LPAGSPKPTRFANDLVRLLKSVADFDISVAAYPEVHPDAPNAQADLINLKKKIDAGANRA
ITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVTNFTQLKRFAGMTNVSIPSWLHKQFE
GLDDDPSTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAELTYAICHTLGVRPGK