Protein Info for Shew_0504 in Shewanella loihica PV-4

Annotation: NnrS family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF05940: NnrS" amino acids 15 to 397 (383 residues), 349 bits, see alignment E=2e-108

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to slo:Shew_0504)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA78 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Shew_0504 NnrS family protein (RefSeq) (Shewanella loihica PV-4)
MLNIDDPSVVDKTPAIWRLGFRPFFLGGALLATLYVPLWLISWYLPEMSLLRSQFWVKVV
PLWWHPHELLFGFAVAIVSGFLLTSVQTWTNQPSLKGWPLALVFACWLLARVLLLSPFEL
PVWLPGLFDSLFLLLTAAKLWSCIYRVKQWRNIGFPIMLLVATGINLLSYYALSQRDFVL
SHHIWQGMLWWLGLLITIVGGRVIPFFTAVRVKQAKPEPIKALDLSLIALMILLIAQGIT
KYLTPGAEQALLAVTALAHLLRWSRWLPHKTLGEPMLWSLQLAYLCLPLTLAALAWNIDD
ENAYRHLLHLFAIGTMAGLCLSMISRVSLGHTSRNIYQGPKMSLAFLGITLAALCRAVMP
LWFPEYSELWLWIAGSCWSLAFGWFVWCYAPILTRPRVDGRPG