Protein Info for Shew_0497 in Shewanella loihica PV-4

Annotation: putative sulfate transporter YchM (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 77 to 108 (32 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 162 to 188 (27 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 343 to 382 (40 residues), see Phobius details amino acids 401 to 432 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 19 to 404 (386 residues), 267.9 bits, see alignment E=1.3e-83 PF01740: STAS" amino acids 451 to 539 (89 residues), 49.7 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to slo:Shew_0497)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA71 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Shew_0497 putative sulfate transporter YchM (RefSeq) (Shewanella loihica PV-4)
MFSAVKKSISAKPSFQEIQTNILAGLTVGVIALPLSMALAIASGVPPQHGLYTAMIAGIV
IALCGGSKVNISGPTAAFVVILLPIVQQFGLGGLLLSGLMAGVILLLMGLGKLGKLIEIV
PYPVTVGFTAGIGVVIATFQIKDFFGLEVAAGGEHYLEKLSYILQALTSISWQETLIGAL
TLAVLLAWPKLKSKVPAHLAALLVGALIAWVMTQMIGGFSVATIGSRFHYELDGLLGSGI
PPIMPSFEWPWNLPGADGQPIGMSFELVRELLPSAITIAILGALESLLCAVVADGMSGKK
HNPNDELIGQGLGNILVPLFGGIPATAAIARTAANVKAGGSMPLASVVHGLFILAGILLL
APLLSYIPMASMAALLLVVAWNMSEAKHFVRTLKVAPRDDVLILVLCFALTVLFDMTIAV
AVGMGLAAMLFIRRSISLTDARAVETNHQAYEVPESVVVYDINGPLFFGSAHKALKTIAL
VRPDVRVVILDMSEVTLLDMSAIVAMESIAQDLSGKQVALIINNLQPRMLLKLRRAGIRK
RRGQVEYARTMDDSFALAQRMTAQA