Protein Info for Shew_0487 in Shewanella loihica PV-4

Annotation: redox-active disulfide protein 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13192: Thioredoxin_3
  • amino acids 1 to 75 (75 residues), 89.2 bits, E=7.4e-30
• TIGR00412: redox-active disulfide protein 2
  • amino acids 1 to 76 (76 residues), 74.4 bits, E=3.2e-25

Best Hits

Swiss-Prot: 34% identical to THIRX_METTH: Thioredoxin (MTH_895) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0487)

MetaCyc: 51% identical to roxarsone(III) nitroreductase (Shewanella putrefaciens 200)
1.7.99.M1 [EC: 1.7.99.M1]; 1.7.99.M1 [EC: 1.7.99.M1]

Predicted SEED Role

"redox-active disulfide protein 2"

MetaCyc Pathways

• roxarsone (and nitarsone) degradation III (2/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.99.M1

Sequence Analysis Tools

See A3QA61 at UniProt or InterPro

Protein Sequence (82 amino acids)

>Shew_0487 redox-active disulfide protein 2 (RefSeq) (Shewanella loihica PV-4)
MKIEVLGSGCKRCTNLASDIARIADELNLNIELTKVTDMAQIAAYGVMSTPAIVIDGEVL
AAGRLPSEEELAQLLTKINKVQ