Protein Info for Shew_0487 in Shewanella loihica PV-4

Annotation: redox-active disulfide protein 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 82 TIGR00412: redox-active disulfide protein 2" amino acids 1 to 76 (76 residues), 74.4 bits, see alignment E=3.2e-25 PF13192: Thioredoxin_3" amino acids 1 to 75 (75 residues), 89.5 bits, see alignment E=5.7e-30

Best Hits

Swiss-Prot: 34% identical to THIRX_METTH: Thioredoxin (MTH_895) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0487)

MetaCyc: 51% identical to roxarsone(III) nitroreductase (Shewanella putrefaciens 200)
1.7.99.M1 [EC: 1.7.99.M1]; 1.7.99.M1 [EC: 1.7.99.M1]

Predicted SEED Role

"redox-active disulfide protein 2"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.99.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA61 at UniProt or InterPro

Protein Sequence (82 amino acids)

>Shew_0487 redox-active disulfide protein 2 (RefSeq) (Shewanella loihica PV-4)
MKIEVLGSGCKRCTNLASDIARIADELNLNIELTKVTDMAQIAAYGVMSTPAIVIDGEVL
AAGRLPSEEELAQLLTKINKVQ