Protein Info for Shew_0485 in Shewanella loihica PV-4

Annotation: cold-shock DNA-binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 113 to 131 (19 residues), see Phobius details PF00313: CSD" amino acids 4 to 64 (61 residues), 34.7 bits, see alignment E=1.3e-12 PF05901: Excalibur" amino acids 168 to 200 (33 residues), 42.2 bits, see alignment 8.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0485)

Predicted SEED Role

"Cold-shock DNA-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA59 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Shew_0485 cold-shock DNA-binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MERGTLVRWNDDKGFGFIKPNTPNAQDVFIHISALKQMARKPVVGDEIIYQSQQQSDGKI
KAVKASIEGVAVVSGIASGRASGLANKPTRPQHRDHTQSSHYSHRRSGSRLQRMIFIIIL
VSIGSFAIKQYQALNATPVASFEELPAVEAQEWQPATPKFRCEAGKIHCSQMSSCQEAKF
YLRNCPGTEMDGDHDGIPCERQFCG