Protein Info for Shew_0479 in Shewanella loihica PV-4

Annotation: HipA domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF13657: Couple_hipA" amino acids 9 to 105 (97 residues), 67.5 bits, see alignment E=1.3e-22 TIGR03071: HipA N-terminal domain" amino acids 10 to 105 (96 residues), 49 bits, see alignment E=2.8e-17 PF07804: HipA_C" amino acids 146 to 385 (240 residues), 160.5 bits, see alignment E=4.8e-51

Best Hits

Swiss-Prot: 71% identical to HIPA_SHEON: Serine/threonine-protein kinase toxin HipA (hipA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07154, (no description) (inferred from 100% identity to slo:Shew_0479)

Predicted SEED Role

"HipA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QA53 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Shew_0479 HipA domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MAESPILVLDMLLGDQLIGALSFDPSDERFAVSYTQAWQQSGFPLSPTIPLDGSGSSTQI
AMFLVNLLPENKGLDYLVESLGVAKGNTFALIRAIGLDTAGAIAFSSKGSAFPPTTLRTI
SDDEIVQRLEDPEFWPMEIWDGRPRLSVAGVQSKLNLFFNGEEFGFGEGALSSTHILKFE
QHPHLVINEFLTMRLAKALALKVANVEIRCFGQYKSLCVERFDRRYLDDENRVQRRHIID
SCQALGFSVNKKYERNFGSGRDVRDIREGVSLPRLFGLANQCINPAAAKQDMLRWTLFNL
LSGNADAHGKNYSFFMTPNGMLPTPWYDLVCVALYEDFEQELAMAIDDEFDPNKIYAYQL
AAFSEEVGLPRALIVNSLDKMVAKIRLEINGVIAMLKDLDEDEQAFVEAYKAQLLARCER
YSAIAPEIKAIEL