Protein Info for Shew_0425 in Shewanella loihica PV-4

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 12 to 364 (353 residues), 64.4 bits, see alignment E=2.1e-21 PF12698: ABC2_membrane_3" amino acids 27 to 358 (332 residues), 182.3 bits, see alignment E=2.9e-57 PF01061: ABC2_membrane" amino acids 161 to 330 (170 residues), 118.8 bits, see alignment E=5e-38

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to slo:Shew_0425)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Z9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Shew_0425 ABC-2 type transporter (RefSeq) (Shewanella loihica PV-4)
MLLASLRRIKSITTKEIRQLKRDRITFGMVVMIPLIQLLLFGYAINTDVRNVPVVVVDQS
HSAAGRWIVEAVKVTQVVSIEKHYASAEEAEAAITRGEVRAALILPPNLTEKLANGETLG
QWVVDGSDTMVASAISQLRNMPLDQITGQDTQRLPTFEVALFYNPEQRSAVNIVPGLIAV
ILTMTMILFTSAAIVRERERGNLELLITTPIKPLELMLGKIVPYILVGLVQMTIILGLGH
LIFDVPINGAIAQLLMGTLLFIAASLTLGLIISTIAKTQLQAMQMTIFIILPTILLSGFM
FPFEAMPKPAQWIAELLPATHFMRIIRAIVLRGGALSDMQFDALWLIGFTLVGILVASLR
FNKRLD