Protein Info for Shew_0420 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 162 to 193 (32 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 344 to 347 (4 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 384 to 407 (24 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 310 (287 residues), 66.1 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0420)

MetaCyc: 72% identical to 1-arseno-3-phosphoglycerate exporter (Pseudomonas aeruginosa)
TRANS-RXN1YI0-17

Predicted SEED Role

"Permease of the major facilitator superfamily"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Z4 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Shew_0420 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MMLASLRALPSEMRQYLLVTGNYWAFTLTDGALRMLVVLHFHQLGYSPLSIAMLFLFYEI
FGVVTNLVGGYLGARLGLNRTMNIGLGLQVAALAMLLVPSSWLVVPWVMAAQALSGIAKD
LNKMSAKSSVKMLVAKGEEDRLYKYIAVLTGSKNALKGAGFFLGGALLALLGFKGAIGLM
AALLAIVWLVSIIKLKQDLGKAKNKPKFTELFSKSRAINILSAARMCLFAARDVWFVVAL
PVYLASQFGWDHYQVGGFLALWIIGYGAVQSLAPRVTGKASGQVPDGRSAMWWASALTII
PALIAYLMSGELAALAPGFNLGVLLLGLMLFGAVFAVNSSLHSYLIVSYASDDGVSLDVG
FYYMANAMGRLLGTILSGWVYQAYGLGACLWISTGLLGLTVVISVGLPRR