Protein Info for Shew_0418 in Shewanella loihica PV-4

Annotation: arsenical-resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 54 (23 residues), see Phobius details amino acids 75 to 102 (28 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 1 to 329 (329 residues), 420.3 bits, see alignment E=2.8e-130 PF13593: SBF_like" amino acids 14 to 317 (304 residues), 35.4 bits, see alignment E=7.8e-13 PF01758: SBF" amino acids 47 to 242 (196 residues), 147.6 bits, see alignment E=3.6e-47

Best Hits

Swiss-Prot: 55% identical to ACR3_ALKMQ: Arsenical-resistance protein Acr3 (acr3) from Alkaliphilus metalliredigens (strain QYMF)

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 100% identity to slo:Shew_0418)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Z2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Shew_0418 arsenical-resistance protein (RefSeq) (Shewanella loihica PV-4)
MGLFERYLSVWVGLAIVAGVGLGYLLPQQFALIASFEYASVNLLIAVLIWVMIYPMMVQI
DFSAVKDVGKRPKGLLLTLVVNWLIKPFTMALLGWVFFRVLFASWVDPQTASEYIAGMIL
LGVAPCTAMVFVWSQLTKGNPNYTLVQVSVNDIIMVFAFAPICAFLLGVSDIQVPWQTLL
ISVVLYVVLPLVAGIATRKVLNKKGHILSVEAFVARLKPWSILGLLATVVLLFGLQANTI
LAQPQNILLIAIPLLLQTYGIFFIAYLAAKRMRLEQDVAAPACMIATSNFFELAVAVAIS
LFGLHSGAALATVVGVLVEVPVMLSLVAFVNRDKTNYLRGLGKA