Protein Info for Shew_0414 in Shewanella loihica PV-4

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 20 to 368 (349 residues), 170.1 bits, see alignment E=7.5e-54 PF01061: ABC2_membrane" amino acids 232 to 337 (106 residues), 37.2 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to slo:Shew_0414)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Y8 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Shew_0414 ABC-2 type transporter (RefSeq) (Shewanella loihica PV-4)
MNLFALMFEELKAIVTDKAIAITLFGGVIFYSVLYPLPYLNEVPTRQQIVVVDGDHSSLS
RLVIRHAQASPKLEVVAQVDDLTQAQAAVNSGQAHGYLVIPEGFRRDLLRQRGVTLAYGG
DANYFLVYSAILEGLVSVGIDAGKYIQFQGLLARGEAAKQVQRELEPIHLNSVPAFNPSL
GYTSYVVPGVLLLVLHQTLLIGTGILGAGQWRRQGYWHSVGLGQLLSARVATFGLIYSLF
TAYYIGYCHYWYQVGVQGNLGQVCLFLLPFLLATSLAGIAFSSLFVRRDLPTQVLLLISM
PILFVSGFVWPVELIPAPLQAVSQLIPGVVTIKGMLQLNQMGADWQSVAPLWWQLWGLVL
FYLLLAYLGLRLRLETRKSPH