Protein Info for Shew_0413 in Shewanella loihica PV-4

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 352 to 369 (18 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 17 to 369 (353 residues), 167.7 bits, see alignment E=4e-53 PF01061: ABC2_membrane" amino acids 177 to 333 (157 residues), 35.8 bits, see alignment E=6.5e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to slo:Shew_0413)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Y7 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Shew_0413 ABC-2 type transporter (RefSeq) (Shewanella loihica PV-4)
MGQLITRELRRLWQSPWQLALVSYLPLLGTLALWWLFSAGLPRALPVAVVDQDQSQLSRM
LVRQLSANSVISPVSYQDIGQAQAAMERAEAYAMVVLPFKLNQDLMIGHQPSIDIRYNAQ
FLLVGKLLSSQIQLSLADGLKQKARLKQLASGVPPVQAEINLNLIKTQSSALYNANNNYV
AFLVPPILIALVQIVAMLVFANALTEELRRETLAEWFSLGTYRVLLSKVLVYTPLLMLQL
GLVYAWLYGYLGLPMRGGLGQLLIAQLVMLLAVWLIVLTIFALLQDSARVISFCTALFAP
SFAFMGVTFPTHEMPLLAQWWRQIMPSSHYVNTHIGVIAYGQETQALVSQLSSYWGFLLL
LPVIALMLAKMRREQTGEQLDQAQIVEGQG