Protein Info for Shew_0379 in Shewanella loihica PV-4

Annotation: primosomal protein N' (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 PF17764: PriA_3primeBD" amino acids 6 to 103 (98 residues), 97.6 bits, see alignment E=1.1e-31 PF21213: WHD_PriA" amino acids 119 to 177 (59 residues), 31.8 bits, see alignment 3.9e-11 PF04851: ResIII" amino acids 201 to 361 (161 residues), 52.3 bits, see alignment E=2.3e-17 PF00270: DEAD" amino acids 204 to 368 (165 residues), 69 bits, see alignment E=1.5e-22 TIGR00595: primosomal protein N'" amino acids 223 to 727 (505 residues), 590.4 bits, see alignment E=1.5e-181 PF18319: Zn_ribbon_PriA" amino acids 447 to 471 (25 residues), 32.6 bits, see alignment (E = 2.2e-11) PF00271: Helicase_C" amino acids 496 to 590 (95 residues), 33.4 bits, see alignment E=1.6e-11 PF18074: PriA_C" amino acids 636 to 727 (92 residues), 71.9 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 100% identity to slo:Shew_0379)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9V3 at UniProt or InterPro

Protein Sequence (731 amino acids)

>Shew_0379 primosomal protein N' (RefSeq) (Shewanella loihica PV-4)
MSLFVEVALPVPMRQAFSYRVKEADLDKAQVGVRVRVPFGRQQLIGLVTGLSQSCDLAPN
QIKSVITFLDHEGVLPPSLYKLTQWAARYYFCSLGQMLSQALPVALRKGAEVEAQQLQVW
RVTAAGQEADIDLLKRAPAQRKLLLALLETELSQDELNALEQSKTALKALVERGWIECIE
RRIESNLSWRDGLELDETPHQLNPEQAIAVAMLNQQQGYHCTLLEGITGSGKTEVYLALL
ETVLKQGKQALILVPEIGLTPQTISRFKRRFKVQVAVIHSGLTDNQRLSAWRLARSGEAA
IIIGTRSALFTPMRYPGIIILDEEHDASFKQQEGIGYHARDLAVMRGHLESIPVLLGSAT
PSLETLQNALSGRYQHLSLGSRAGAAEKVRQGIIDIRNQPLKNGLSHGLLNEMRIHLDAG
NQVLLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQSLGEIRCHHCGNQYAIPRQCHQ
CGSTMLMGQGVGTEQLADALAKEFPNYPVVRIDRDTTSRKGALETHLNAIHKGEYKILVG
TQMLAKGHHFPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVSGRAGRARKPGTVLLQT
HQCDNPILRELMHKGYGEFARGQLEERKQALLPPAWHMLLLRAEAHKAEDADAFLAQVAQ
LLPQDEQCEIIGPMPAPMDRKAGKFRRQLMFQTKTRGLLQQAFEQALPQIEALPLAKRCR
WSLDRDPQDLL