Protein Info for Shew_0375 in Shewanella loihica PV-4
Annotation: ATP-dependent protease peptidase subunit (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to HSLV_SHELP: ATP-dependent protease subunit HslV (hslV) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)
KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to slo:Shew_0375)MetaCyc: 82% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.4.25.- or 3.4.25.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3Q9U9 at UniProt or InterPro
Protein Sequence (174 amino acids)
>Shew_0375 ATP-dependent protease peptidase subunit (RefSeq) (Shewanella loihica PV-4) MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNARKVRRLYHNKVLAGFAGGTADAFTLFER FESKLEMHQGHLMRAAVEMAKDWRSDRVLRKLEALLAVADTECSLIITGNGDVVQPENDL IAIGSGGNFAQAAATALLENTDLSAKEIAEKSLTIAGDICVFTNQFKTIEELNY