Protein Info for Shew_0366 in Shewanella loihica PV-4

Annotation: ubiquinol oxidase, subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 12 to 235 (224 residues), 373.5 bits, E=1.6e-116
• PF06481: COX_ARM
  • amino acids 235 to 279 (45 residues), 60.2 bits, 7e-21

Best Hits

Swiss-Prot: 61% identical to CYOA_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas putida

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to slo:Shew_0366)

MetaCyc: 61% identical to cytochrome bo terminal oxidase subunit II (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A3Q9U0 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Shew_0366 ubiquinol oxidase, subunit II (RefSeq) (Shewanella loihica PV-4)
MLIRNFAKASCAMAALMLAGCEGGVLDPKGQVGIDEKQLIVIATLLMLIVVIPVIVMTLY
FAWKYRDGRDHEIYAPKWAHSKTIELVVWCVPIVIVGILGVITWHSTHKLDPYQPLEHEA
EPIIVEVVSLNWKWLFIYPEQGIASVNELAFPANVPVNFKISSDTAMNSFFIPQLGSQIY
SMAGMTTKLHLIANEPGTYKGISANYSGAGFTGMKFNAIATPTRDDFNAWVAKVKREGAA
LGQESYRELAKESSNNPVSYYASVSDGLFEQIVMQYMHQHQMPAQEGMAMPAATLHGQSH
EQVHASESSNTTGGEH