Protein Info for Shew_0363 in Shewanella loihica PV-4

Annotation: nucleotidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02254: noncanonical pyrimidine nucleotidase, YjjG family
  • amino acids 3 to 222 (220 residues), 258.1 bits, E=9.6e-81
• PF00702: Hydrolase
  • amino acids 5 to 189 (185 residues), 81.2 bits, E=2.1e-26
• PF13419: HAD_2
  • amino acids 6 to 194 (189 residues), 66.1 bits, E=6.5e-22
• TIGR01549: HAD hydrolase, family IA, variant 1
  • amino acids 100 to 189 (90 residues), 52 bits, E=1.6e-17
• PF13242: Hydrolase_like
  • amino acids 149 to 217 (69 residues), 42.4 bits, E=8e-15

Best Hits

Swiss-Prot: 60% identical to YJJG_ECO57: Pyrimidine 5'-nucleotidase YjjG (yjjG) from Escherichia coli O157:H7

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to slo:Shew_0363)

MetaCyc: 60% identical to pyrimidine 5'-nucleotidase YjjG (Escherichia coli K-12 substr. MG1655)
3.1.3.M8 [EC: 3.1.3.M8]; 5'-nucleotidase. [EC: 3.1.3.M8, 3.1.3.5]

Predicted SEED Role

"5'-nucleotidase YjjG (EC 3.1.3.5)" (EC 3.1.3.5)

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (3/7 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• NAD salvage (plants) (3/11 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.M8

Sequence Analysis Tools

See A3Q9T7 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Shew_0363 nucleotidase (RefSeq) (Shewanella loihica PV-4)
MKYQWILFDADETLFHFDAFKGLQLMFSRFGVDFTLADFEEYQTVNLPLWVDYQDGKISA
RHLQVTRFERWAEKLSVTAEHLNSAFLTAMADICTLLPGAAELVDALYGKVKMGIITNGF
TDLQTVRLERTGLLHAFSPVVISEEVGVAKPDVAIFEHALSQMAHPPREHVLMVGDNPHS
DIQGGLNAGFDTCWLNRASQPVPEGITPHYQVASLTELQHLLLKG