Protein Info for Shew_0353 in Shewanella loihica PV-4

Annotation: polysulphide reductase, NrfD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details PF03916: NrfD" amino acids 11 to 313 (303 residues), 212.1 bits, see alignment E=1.6e-66 PF14589: NrfD_2" amino acids 16 to 312 (297 residues), 43 bits, see alignment E=4.9e-15

Best Hits

Swiss-Prot: 36% identical to NRFD_ECOLI: Protein NrfD (nrfD) from Escherichia coli (strain K12)

KEGG orthology group: K04015, formate-dependent nitrate reductase complex, transmembrane protein (inferred from 100% identity to slo:Shew_0353)

MetaCyc: 74% identical to SirD quinol--ferredoxin oxidoreductase (Shewanella oneidensis MR-1)
RXN-18578

Predicted SEED Role

"NrfD protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9S7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Shew_0353 polysulphide reductase, NrfD (RefSeq) (Shewanella loihica PV-4)
MDGTLEFTMGLSEGVAWPWPIAVYLFFAGISGGALSVALFIRFYKQQSANTPFLKASALI
AFVTIALGMLCLVLDLTNPLFFWRILVYYNLNSVMSVGVIALSAYIPLVALIALFALEEE
IRRLPMLAPLLPLIDKLRPWRRSSETLVLVLALAVCAYTGFLISALIRFPIINTSVLPAL
FVASGLSAGAAAAKMLAVGLFKEDRHSSDMQILHGAEWPIMFAEALFLFMIIMSLVTGNA
GAQSAFEAFHTGSWSMVFWLGVVGVGFGGPLLLNFATGERFSHSSQAFYLSGLCAVSGMM
CLRMFILYAGQNFAI