Protein Info for Shew_0352 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF13247: Fer4_11" amino acids 81 to 175 (95 residues), 77.8 bits, see alignment E=2.1e-25 PF13187: Fer4_9" amino acids 86 to 133 (48 residues), 27.6 bits, see alignment 8.5e-10 PF12838: Fer4_7" amino acids 86 to 133 (48 residues), 31 bits, see alignment 1e-10 PF12837: Fer4_6" amino acids 111 to 133 (23 residues), 28 bits, see alignment (E = 5.2e-10) PF00037: Fer4" amino acids 113 to 134 (22 residues), 25.9 bits, see alignment (E = 2.3e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0352)

MetaCyc: 81% identical to SirC ferredoxin (Shewanella oneidensis MR-1)

Predicted SEED Role

"NrfC protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9S6 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Shew_0352 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MLAPLGCSVKEQTAQDAAPHYVMVFDQNKCVGCGGCKEACNKANNLPEGRSRVLLEQQSS
AVAGQACPHCGKTDCDCQRKYVRVSCQQCQNAPCVSVCPTGAAHRDPKTGIVTMDASKCA
GCKYCIAACPYNARYINSETDVADNCDFCLQSKLAKGELPACVQECRYDALVFGDANDPN
SYVSRLLAVKDSVRVKAHLGTEPSLRYIPIVKLGV