Protein Info for Shew_0351 in Shewanella loihica PV-4

Annotation: TPR repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details PF13432: TPR_16" amino acids 92 to 134 (43 residues), 27.9 bits, see alignment 8e-10 PF14559: TPR_19" amino acids 93 to 141 (49 residues), 28.8 bits, see alignment 3.7e-10 PF13174: TPR_6" amino acids 103 to 133 (31 residues), 24.1 bits, see alignment 1.3e-08 PF07719: TPR_2" amino acids 103 to 133 (31 residues), 24.6 bits, see alignment 5.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0351)

Predicted SEED Role

"Cytochrome c-type heme lyase subunit nrfG, nitrite reductase complex assembly" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9S5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Shew_0351 TPR repeat-containing protein (RefSeq) (Shewanella loihica PV-4)
MISLVFAMAVTLVCFIAPIWRHYFIQEENALAGDATIPARKQTLTPIVVTGMLLLIPLTL
YGLLGRFNDWHTGQIDENIDYLIAADINKNARILDDTPLDRLALLNLANAYAEGGRYSEA
VETLDKLLAIAPDAELYGMKATALYYRDNRAMSLEVSLVISQALALDPEEVQSLLLMATH
AYLNKDFQQAIVHWRQLLDSDNPNINRASINSAIVNAEQKMANRTVTASE