Protein Info for Shew_0332 in Shewanella loihica PV-4

Annotation: fumarate reductase cytochrome b-556 subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details PF01127: Sdh_cyt" amino acids 109 to 217 (109 residues), 42 bits, see alignment E=4.8e-15

Best Hits

Swiss-Prot: 43% identical to FRDC_HELPY: Fumarate reductase cytochrome b subunit (frdC) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K00246, fumarate reductase subunit C (inferred from 100% identity to slo:Shew_0332)

MetaCyc: 43% identical to fumarate reductase cytochrome b subunit (Helicobacter pylori 26695)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase cytochrome b subunit" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9Q6 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Shew_0332 fumarate reductase cytochrome b-556 subunit (RefSeq) (Shewanella loihica PV-4)
MKVNSLQYQHTHYAALGSPWSAKADRIQSATGILLGCFLLAHLHFESSILFGKETFYHVV
QFLEGGMFSSTGHGMPIVTKVFSIFIMLVVMLHAAVALRRFPAQLGQWRALRNHMQGIKH
KDSHAWFWQLVTGFILFFLAPVHIFTMITNPEIGPHLSAERVYHANAWLLYALLLPAVVV
HAMIGLYRVAVKWGLIRHRKGLRKAIKVLIIYLMTLGILSLISYIMIGRSLVLPITPFVP