Protein Info for Shew_0320 in Shewanella loihica PV-4

Annotation: frataxin family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF01491: Frataxin_Cyay" amino acids 16 to 103 (88 residues), 100.3 bits, see alignment E=3.4e-33 TIGR03421: iron donor protein CyaY" amino acids 18 to 122 (105 residues), 122.9 bits, see alignment E=2.6e-40

Best Hits

Swiss-Prot: 81% identical to CYAY_SHEON: Iron-sulfur cluster assembly protein CyaY (cyaY) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06202, CyaY protein (inferred from 100% identity to slo:Shew_0320)

Predicted SEED Role

"Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9P4 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Shew_0320 frataxin family protein (RefSeq) (Shewanella loihica PV-4)
MWALQQPTPLKDAQMAMTDSEYHQLADEMFTALEDAIENAIDEQDADIDIDASGNVLQLE
FQDKSKIVINKQEPLHQIWVATQFGGYHFSYVEGKWLDERSDAGEFMPFVLASILRQGGI
ALSL