Protein Info for Shew_0310 in Shewanella loihica PV-4

Annotation: TolC family type I secretion outer membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 29 to 459 (431 residues), 321.9 bits, see alignment E=3.3e-100 PF02321: OEP" amino acids 32 to 227 (196 residues), 106.1 bits, see alignment E=1e-34 amino acids 254 to 445 (192 residues), 97.6 bits, see alignment E=4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0310)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9N4 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Shew_0310 TolC family type I secretion outer membrane protein (RefSeq) (Shewanella loihica PV-4)
MSKQTMHQLKRSAMALAISAMLIPGAASSQTLEQAVAHTLDTNPDIRIAFNRFKAREEQV
NQAIAGYMPTVDISGGYGWEQTNSPSTRRRAGQGDVDKDGVIELMRGEVGFSIKQMLFDG
FYTSSEVDRFSFEASADQWALFAAAEDIALDVAKVYVNYIRSEQVLTLAEKNLQSHKDIY
DQIKQRTDSGLGSVADLSQITGRLARANANVIAAKNNFFDAKAQFIRIVEKEPENLIVPV
PDDDMLPTNLTDGLKVAQENHPILKSAASDISAAENERSSAQSNYYPKLSLELGGNWNDN
LDGEDGYSAFASQNVGGHNNDLIAMVRVKYNLFAGGKDLAREKEAAYKIGEAKEIRQRAY
RQVVEGVNLAWNAYEMLEPQKLYIRDHVIAAKDTQVAYSQQFNLGQRTLLDLLDTENELF
EARKDYLDAEYDEIISEYRILNATGRLLESLRVTRPEVWKGEREYEGGVK