Protein Info for Shew_0302 in Shewanella loihica PV-4

Annotation: phosphoesterase, PA-phosphatase related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 9 to 35 (27 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details PF14378: PAP2_3" amino acids 74 to 240 (167 residues), 27.3 bits, see alignment E=3e-10 PF01569: PAP2" amino acids 84 to 249 (166 residues), 98.2 bits, see alignment E=3.2e-32

Best Hits

KEGG orthology group: K01096, phosphatidylglycerophosphatase B [EC: 3.1.3.27] (inferred from 100% identity to slo:Shew_0302)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9M6 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Shew_0302 phosphoesterase, PA-phosphatase related (RefSeq) (Shewanella loihica PV-4)
MRSNPPSNLYFSVVLLWSGLTLIPAAIYLGGLSLFPWLELSSLKAQILFGLTSSGTAPYG
VLTVLALLLACYLLLPRKQLVPLLFSVCLAMGLSLGLNHFLKPYFGHPRPNVQFLAENQG
LSLSGFYQASQPTRRILMAQEVAKLSQEIKLPQETKLSLSPKIAQHWQDEVGYSFPSGHT
LFAVTLTLVVSYFLLAAQRFLFAALLCLWALAMGFSRMLLGMHWPQDVLAASLLGGLIAL
LALLITEKWRAIGQG