Protein Info for Shew_0281 in Shewanella loihica PV-4

Annotation: phospholipid/glycerol acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details PF01553: Acyltransferase" amino acids 77 to 213 (137 residues), 42.8 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0281)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9K5 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Shew_0281 phospholipid/glycerol acyltransferase (RefSeq) (Shewanella loihica PV-4)
MLNFLPGPLLFALSLTLLIINTVLWSTLICVGGIIKLLLPIALLRTGIAHLMNRCMWSWA
CINGGILFLIAKIEWDIEGLEGLKKDGWYLLISNHLSGFDIAALTYVLRNNIPMLKFFLK
KELLYVPFLGLGCWALDMPFMNRTSAKQLRKNPKLKGKDLETTRRSCEKFRTIPTSIINY
VEGSRFTPEKKARQRSPYRYLLRPKAGGIAFTISAMGEQFTSLLNVTLVYPDSADNTLSE
VMHGKVKRIVVRIESMPVPEVDDQQYFNDAECRAQFQRWLNGVWQQKDEQIHQILTRYNS
DQLVSEETRSLAESR