Protein Info for Shew_0281 in Shewanella loihica PV-4
Annotation: phospholipid/glycerol acyltransferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to slo:Shew_0281)Predicted SEED Role
"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)
MetaCyc Pathways
- phosphatidylglycerol biosynthesis I (6/6 steps found)
- phosphatidylglycerol biosynthesis II (6/6 steps found)
- superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
- CDP-diacylglycerol biosynthesis I (4/4 steps found)
- CDP-diacylglycerol biosynthesis II (4/4 steps found)
- oleate biosynthesis III (cyanobacteria) (2/3 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
- palmitoleate biosynthesis III (cyanobacteria) (1/2 steps found)
- phospholipid remodeling (phosphatidate, yeast) (1/2 steps found)
- CDP-diacylglycerol biosynthesis III (3/5 steps found)
- phosphatidate biosynthesis (yeast) (3/5 steps found)
- diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
- palmitoyl ethanolamide biosynthesis (2/6 steps found)
- superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
- stigma estolide biosynthesis (2/7 steps found)
- anandamide biosynthesis II (2/8 steps found)
- anandamide biosynthesis I (4/12 steps found)
- superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)
- plasmalogen biosynthesis I (aerobic) (1/16 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.51
Use Curated BLAST to search for 2.3.1.51
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3Q9K5 at UniProt or InterPro
Protein Sequence (315 amino acids)
>Shew_0281 phospholipid/glycerol acyltransferase (RefSeq) (Shewanella loihica PV-4) MLNFLPGPLLFALSLTLLIINTVLWSTLICVGGIIKLLLPIALLRTGIAHLMNRCMWSWA CINGGILFLIAKIEWDIEGLEGLKKDGWYLLISNHLSGFDIAALTYVLRNNIPMLKFFLK KELLYVPFLGLGCWALDMPFMNRTSAKQLRKNPKLKGKDLETTRRSCEKFRTIPTSIINY VEGSRFTPEKKARQRSPYRYLLRPKAGGIAFTISAMGEQFTSLLNVTLVYPDSADNTLSE VMHGKVKRIVVRIESMPVPEVDDQQYFNDAECRAQFQRWLNGVWQQKDEQIHQILTRYNS DQLVSEETRSLAESR