Protein Info for Shew_0276 in Shewanella loihica PV-4

Annotation: flavocytochrome c (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 29 (27 residues), 17.5 bits, see alignment (E = 3.9e-07) PF00890: FAD_binding_2" amino acids 42 to 484 (443 residues), 195.9 bits, see alignment E=3.5e-61 PF12831: FAD_oxidored" amino acids 42 to 164 (123 residues), 34.2 bits, see alignment E=4.7e-12 PF01266: DAO" amino acids 42 to 256 (215 residues), 44.3 bits, see alignment E=4.4e-15 TIGR01813: flavocytochrome c" amino acids 42 to 496 (455 residues), 523.9 bits, see alignment E=3.2e-161 PF13450: NAD_binding_8" amino acids 45 to 81 (37 residues), 28.5 bits, see alignment 3.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0276)

Predicted SEED Role

"Flavocytochrome c flavin subunit" in subsystem Flavocytochrome C

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9K0 at UniProt or InterPro

Protein Sequence (505 amino acids)

>Shew_0276 flavocytochrome c (RefSeq) (Shewanella loihica PV-4)
MHNRRNFLKLSAGAAIGGMAAALPSTSLAKECQAIKWDESHDVIIVGSGFAGLSAALNTK
RQGIKSVLVLEKMQVIGGNSAINGGWLAIPKNPIQLAQGIEDDSPEELVKDQIISGRGMQ
NETALRQIANRALDAYELCIGTGVKFRDGFNIQVGGHNKARAIRTQHGSGGDITTKLYEA
GVREGVEYRLQHYIEDFIMDGQEIVGVKVRKNYRFPDITTGSTIYIRANKAVILANGGFA
RNMKLREMVDPSLDPTLDCTNALGATGEVTLTAMAHGALPVHMNLIQTGHWGSPDEGGFG
WSNALLSIGWHQGAAISVLNGKRFMDERADRKTCSEAIMKNRYPDNSPAYPVVLFNYEKY
KDDDRVVRALRDKMAWKLDSLDEIASKFNIPAAELKRSINEYNGHVNARKDPLFNRKMDT
AEVLTGPFVVSRIWPKVHYCMGGLKTDLAARVIDGRSMSPIKKLYAIGEVTGGIHGEARL
SSTSCLECLAMGIVVSETIKSDAQA