Protein Info for Shew_0242 in Shewanella loihica PV-4

Annotation: molydopterin dinucleotide-binding region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF04879: Molybdop_Fe4S4" amino acids 52 to 100 (49 residues), 24.9 bits, see alignment 2.4e-09 PF00384: Molybdopterin" amino acids 104 to 520 (417 residues), 119.4 bits, see alignment E=2.8e-38 PF01568: Molydop_binding" amino acids 620 to 730 (111 residues), 71.1 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0242)

Predicted SEED Role

"Anaerobic dehydrogenases, typically selenocysteine-containing" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9G6 at UniProt or InterPro

Protein Sequence (737 amino acids)

>Shew_0242 molydopterin dinucleotide-binding region (RefSeq) (Shewanella loihica PV-4)
MKMNRRTFLQGVGASSVVGSLSGLMPGIASAGEKGGAPDKLLKRQGEIKYHTCQRNCADR
CLLKFTVQNGRMTYVEGASELKKMGTSPCVKGHAYVQYTYAADRILHPMERAGKKGEGKW
RRISWDEAYDKIASRLQQIIKDHGADSILPYSYSGHEGVIGKYGGPSRFFNAVGARKLDR
KVCVFAAYEGLKSVTGTYQGPDPYDNIYTNCYISWGQNETATNVHGIKFINQARDRGAKL
LVVNPVRTPIASQADIWLQPKPSTDTHLATGIMKYLVEHDLADLEFIKANTLGYDQLLER
LNTMSYEEIERVTGVPKAKMFEFARVYGESELSVLRLGYGMQRNYNGARMSRAIAMMHAV
AGQYGKIGNGFIYDNTQADDSLNYSKGRADHIHPNPDTVGHVNMTEIAKALDPENPMAYG
KPIKPIKAVINYNGNFVSVAPDSNACRRGAMRDDLFLVVHDFLMTDTAELADIIVPAATQ
FEFPDMGTDYNCYHMQTSEKVIEPLGESKDNWIFFKELGARMGLDRFPEMRVDYEQILRD
FLDTEEPAFRHNNITYEQIIRDKFVTVYDQRPYFGDGKYKTPSGKIEFYSEMMKEAGYHP
VIDFGLPEDEMVQEEKTLPFRLLSPAIPQRANSSFYNVKYIRNFPAYFAKINAEDAKELG
IQNNDRVRLSNQRGEAHFIAQVSTQVVRGTVMAPKNNWRRMDPQGKDSCTNNLTTDTLTD
MGGCSAYHSTRVAIAKA