Protein Info for Shew_0241 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF13237: Fer4_10" amino acids 12 to 74 (63 residues), 25.7 bits, see alignment E=4.3e-09 amino acids 86 to 140 (55 residues), 27.5 bits, see alignment E=1.2e-09 PF12800: Fer4_4" amino acids 14 to 26 (13 residues), 16.3 bits, see alignment (E = 5.1e-06) amino acids 91 to 105 (15 residues), 22.1 bits, see alignment (E = 7e-08) PF13247: Fer4_11" amino acids 57 to 148 (92 residues), 84.9 bits, see alignment E=1.9e-27 PF12838: Fer4_7" amino acids 60 to 107 (48 residues), 33 bits, see alignment E=3.5e-11 PF25160: LdpA_Fe-S-bd" amino acids 63 to 109 (47 residues), 28.2 bits, see alignment E=6.6e-10 PF12797: Fer4_2" amino acids 85 to 105 (21 residues), 31.1 bits, see alignment (E = 7.5e-11) PF00037: Fer4" amino acids 86 to 108 (23 residues), 35.2 bits, see alignment (E = 3.7e-12) PF12837: Fer4_6" amino acids 86 to 107 (22 residues), 28.4 bits, see alignment (E = 5.4e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0241)

Predicted SEED Role

"Fe-S-cluster-containing hydrogenase components 1" in subsystem Anaerobic respiratory reductases or Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9G5 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Shew_0241 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSLNKKVGFVFRQENCVGCGACTVACQIHNELPENHRFRKVDRYEVKRDDGAIDVWLSHS
CMHCENPACLMVCPAKAYHVRDDGIVVLDREKCTGCGLCASACPYAAVSIREDDGKADKC
NMCVELLDRGMKPACVSGCPVECLDVGNLQEVLKRPSASKQGIGYGDCITKPNLVIIKER
A