Protein Info for Shew_0233 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 PF08497: Radical_SAM_N" amino acids 23 to 378 (356 residues), 464.8 bits, see alignment E=1.7e-143 TIGR03904: uncharacterized radical SAM protein YgiQ" amino acids 23 to 643 (621 residues), 861.3 bits, see alignment E=1.5e-263 PF04055: Radical_SAM" amino acids 379 to 584 (206 residues), 48.1 bits, see alignment E=2.4e-16 PF11842: DUF3362" amino acids 593 to 736 (144 residues), 137.3 bits, see alignment E=7.5e-44

Best Hits

Swiss-Prot: 80% identical to Y311_SHEON: UPF0313 protein SO_0311 (SO_0311) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0233)

Predicted SEED Role

"Probable Fe-S oxidoreductase family 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9F7 at UniProt or InterPro

Protein Sequence (780 amino acids)

>Shew_0233 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MQVESTLFTYPKYLGRNEKPAPFLPMSRKEMAKLGWDSCDIIIVTGDAYVDHPSFGMAVI
GRMLEAQGFRVGIISQPDWSSKEDFMKLGKPNLYFGVTAGNMDSMINRYTAERRLRHDDA
YTAGNVGGKRPDRAVTVYTQRCKEAYKQVPVVIGGIEASLRRIAHYDYWSDKVRRSVILD
AKADILVYGNAERPLVELSHRLAAGESVGDIHDVRGTTVIRKEPLYGWKGMDSRKLDQLH
KIDPVPNPYGADDVGCQNLSGPSDVKVFDNDAPKPISVQPPRPKPWEKTYVLLPSYEKVA
GDKYLYAHASRILHQEQNPGCARALFQPHGERAIWVNPPAWPLNTDEMDGVFDLAYKRVP
HPVYGKEKIPAYDMIKTSINIMRGCFGGCSFCSITEHEGRIIQSRSQDSIIKEIKDIQDK
VPGFTGVISDLGGPTANMYRLGCTSVKAESTCRRLSCVFPSICGHLDTNHQATIDLYRAA
RDVPGIKKVLIASGVRYDLATEDPRYVKELASHHVGGYLKIAPEHTEEGPLNKMMKPGMG
TYDKFKELFDKYSAEAGKKQYLIPYFISAHPGTTDEDMVNLALWLKGEKFKLDQVQNFYP
SPMANATTIYHTELNSLKNVKHSSETVEVPKGGRQRKLHKALLRYHDPAGWPMIREALIK
MGKEHLIGGGANCLVPAETRQERQGYRAKTANTPAGKKAVTRFSANQFDERKGNGQGNAQ
GKSQGKGKSQGQAAGKGVSGKGSTGKGSAGKSSAGKAGSRGKPGKRPVKNAWGTTPKHQR