Protein Info for Shew_0231 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details PF06738: ThrE" amino acids 28 to 267 (240 residues), 215.8 bits, see alignment E=6.7e-68 PF12821: ThrE_2" amino acids 295 to 414 (120 residues), 49.9 bits, see alignment E=3.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0231)

Predicted SEED Role

"Protein of unknown function DUF1212"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9F5 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Shew_0231 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MRSLEHHPQISPSWTVQLDNAEFLEKRRFIIKLGKALHKFGTPAYRLEAHLQSISKVLGI
EGYFLISPTSMTFVLQHDTDQEYNHMARVKPGELDLGSLARTDELVEEVLSGKRTLTEAL
ERLEEIANKPNPYGPLLTLLAFGTSAGAFAMLMGTSWNDVFWSALLGFMVYGLVYRAEHS
KRMAETLEPLAAILCAIAACGIAYFDPYINIPVVILSGIIVFIPGLALTLGLAELAARDL
ISGTARIMDASMLLFKLYFGAIFGMVIGNAIFGEAIYFEPEPLPRWAIWSAVPLLSAALV
IIFKARLKDSPWGIFAGIVAFFSAMLAGIYLGESIGIFFGALAVGIYSNLYARWMKSPAS
IALLQGIVILVPGSKTYIGLNTLILGETMLNQSHIGTQIFLIFMSLIAGLIFANVAVPPR
RTL