Protein Info for Shew_0226 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 TIGR00252: TIGR00252 family protein" amino acids 6 to 114 (109 residues), 101.6 bits, see alignment E=1.4e-33 PF08378: NERD" amino acids 9 to 84 (76 residues), 31.7 bits, see alignment E=1.9e-11 PF02021: UPF0102" amino acids 13 to 102 (90 residues), 94.7 bits, see alignment E=3.5e-31

Best Hits

Swiss-Prot: 100% identical to Y226_SHELP: UPF0102 protein Shew_0226 (Shew_0226) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K07460, putative endonuclease (inferred from 100% identity to slo:Shew_0226)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9F0 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Shew_0226 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MTSAEHLTKGQQAEDRALAYLEQQGLKLVERNVRYPFGEIDLIMRQGHKWIFIEVKYRQS
KQFGGALQAVSRGKIARLNRAASHYMQLNQIDAQCRFDLLAIDGDDIQWITNAF