Protein Info for Shew_0220 in Shewanella loihica PV-4

Annotation: phosphoglycolate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF00702: Hydrolase" amino acids 6 to 187 (182 residues), 113.2 bits, see alignment E=5.3e-36 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 9 to 219 (211 residues), 224.5 bits, see alignment E=2.2e-70 PF13419: HAD_2" amino acids 9 to 192 (184 residues), 127.8 bits, see alignment E=1.2e-40 PF12710: HAD" amino acids 9 to 183 (175 residues), 43.3 bits, see alignment E=1.4e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 62 to 192 (131 residues), 31.5 bits, see alignment E=3.6e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 92 to 187 (96 residues), 31.8 bits, see alignment E=3.6e-11 PF13242: Hydrolase_like" amino acids 150 to 217 (68 residues), 33.9 bits, see alignment E=5.9e-12

Best Hits

Swiss-Prot: 49% identical to GPH_HAEI8: Phosphoglycolate phosphatase (NTHI0697) from Haemophilus influenzae (strain 86-028NP)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to slo:Shew_0220)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9E4 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Shew_0220 phosphoglycolate phosphatase (RefSeq) (Shewanella loihica PV-4)
MKAQSIKAIAFDLDGTLIDSVPDLAAATQGMLAELALPLCDEEQVRSWVGNGAAKLVERA
LTFARGEAATQAYIDAAMPLFSKHYEANLQQHSRLYDGVKSVLEQLVSLGYQLAIVTNKP
YRFTVPLLEAFGIAHLFNQVLGGDSLEKMKPDPLPLTHLKQAWQLEDEQLLMVGDSRNDI
LAAKAAGISSIGLTYGYNYGEDIGLSGPTAVCNTFSEVLAQITDSQIALEQ