Protein Info for Shew_0214 in Shewanella loihica PV-4

Annotation: 3-dehydroquinate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 13 to 353 (341 residues), 402.1 bits, E=1.1e-124
• PF13685: Fe-ADH_2
  • amino acids 17 to 130 (114 residues), 31 bits, E=3.7e-11
• PF01761: DHQ_synthase
  • amino acids 66 to 178 (113 residues), 170.7 bits, E=1.2e-54
• PF24621: DHQS_C
  • amino acids 180 to 324 (145 residues), 186.7 bits, E=3.3e-59

Best Hits

Swiss-Prot: 100% identical to AROB_SHELP: 3-dehydroquinate synthase (aroB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 100% identity to slo:Shew_0214)

MetaCyc: 59% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

See A3Q9D8 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Shew_0214 3-dehydroquinate synthase (RefSeq) (Shewanella loihica PV-4)
MEQIQVELGVRSYPIFIGQNLLENSDYFSSYLQGKKILIVTNDTIAPLYLAKVQALLASY
QCADPVILPDGEQYKTLSQMDAIFTSLLAQNMGRDSVLIALGGGVIGDMTGFAAACYQRG
VDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVAIDTACLHTLPAREFAAG
MAEVIKYGIIWDGSFFSWLEQNVAALKSLDEAALTYAIAKCCQIKADVVAQDETEQGVRA
LLNLGHTFGHAIEAEMGYGVWLHGEAVAAGTVLAAQTASKMGLVDQSIVCRIEAIFEAFD
LPTEAPEAMDFEQFIKHMRRDKKVLNGKLRLVLPKAIGQAEVYGEVSESLLQEVISRA