Protein Info for Shew_0204 in Shewanella loihica PV-4

Annotation: ornithine carbamoyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 3 to 300 (298 residues), 335.7 bits, E=1.2e-104
• PF02729: OTCace_N
  • amino acids 3 to 140 (138 residues), 156.5 bits, E=5.4e-50
• PF00185: OTCace
  • amino acids 147 to 298 (152 residues), 175 bits, E=1.2e-55

Best Hits

Swiss-Prot: 79% identical to OTC_SHEON: Ornithine carbamoyltransferase (argF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to slo:Shew_0204)

MetaCyc: 39% identical to L-ornithine carbamoyltransferase (Sulfolobus acidocaldarius)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See A3Q9C8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Shew_0204 ornithine carbamoyltransferase (RefSeq) (Shewanella loihica PV-4)
MNHLLSIKELTQQQLIDLLALAKTIKANPEDYRKALDGKSVVMLFEKPSLRTRVSFDIGI
NKLGGHCLYLDQQNGALGKREPVSDFAANISCWADAIVARTFAHSTIEQLAEHGTVPVIN
ALSDMYHPCQGLADFLTLAEQFDDVSKVKLAYVGDGNNVTHSLMYGAALLGAKMTVICPQ
GHFPDGKVVLEAQAIAEAHGGELVLSSDVEAIAGHDAIYTDTWISMGDKASLDEIKAKFA
PYHVDTDMMNKAGAKFFMHCLPAYRGVEVAAEVVDGAGSLILQQAENRMHAQNAVLVTLL
S