Protein Info for Shew_0202 in Shewanella loihica PV-4

Name: argC
Annotation: N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 3 to 326 (324 residues), 338.9 bits, see alignment E=1.8e-105 PF01118: Semialdhyde_dh" amino acids 4 to 146 (143 residues), 86.6 bits, see alignment E=2.8e-28 PF22698: Semialdhyde_dhC_1" amino acids 155 to 307 (153 residues), 151.5 bits, see alignment E=3e-48 PF02774: Semialdhyde_dhC" amino acids 164 to 310 (147 residues), 60.2 bits, see alignment E=4.5e-20

Best Hits

Swiss-Prot: 100% identical to ARGC_SHELP: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to slo:Shew_0202)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9C6 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Shew_0202 N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq) (Shewanella loihica PV-4)
MKSIAIIGASGYTGAQVTSLIQADDQLKIQGLYVSENSLDKGKTLASLYPVYSHIDLSLA
PLTEQAKQAIVNEADAVVLATDHGVSLHLAAWFYQAGLAVFDLSGAYRFADSEQYPKWYG
FEHIYPEVLAEAVYGLAEWNTEAIAASKMIAVPGCYPTASLTALKPLKDLMTDSLPVINA
VSGVTGAGRKAQLHTSFCEVSLTPYGVLGHRHQPEIATQLGQQVIFTPHLGNFKRGILAT
ITVQMKPGVSEADIAKAYEVYESAPLVNVYHNQFPKVDDVVHTPNCLLGWKYDPLNGYLV
VASAIDNLMKGAASQAHQCIKIHFNY