Protein Info for Shew_0201 in Shewanella loihica PV-4

Annotation: acetylornithine deacetylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 12 to 378 (367 residues), 441.9 bits, see alignment E=9.2e-137 PF04389: Peptidase_M28" amino acids 63 to 158 (96 residues), 22.5 bits, see alignment E=1.2e-08 PF01546: Peptidase_M20" amino acids 76 to 379 (304 residues), 116.1 bits, see alignment E=3.3e-37 PF07687: M20_dimer" amino acids 177 to 288 (112 residues), 83.7 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 59% identical to ARGE_ERWT9: Acetylornithine deacetylase (argE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 100% identity to slo:Shew_0201)

MetaCyc: 57% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9C5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Shew_0201 acetylornithine deacetylase (RefSeq) (Shewanella loihica PV-4)
MMKTFPDIKQSFRELIATPSISALEAELDMSNQGVVTLLSQWLTDLGFDCQMQAVPDTRG
KHNLLAKIGQGRGGLLLAGHTDTVPFDEGRWSQDPFTLTEKDNRWYGLGSCDMKGFFALV
IEAVRQMPTQDFVRPLYILASADEETTMNGAKAFAQSKAIAPEYALIGEPTGLKPVYMHK
GHLAQGIRITGRSGHSSDPAKGLNAIEIMHQVIGQLLKLKQHLAEHYREEAFSVPYPTMN
FGHIHGGDAANRICGCCDLHLDIRPLPGLPLEVLEQLLTQYLAELSQRYPGSISISQLYP
GSQPFAGQADAQWSQLVAQLSNQAPEVVNYATEAPYIQQLGCQTLVWGPGSIEQAHQPDE
YLDTAYINKTVDLLKQLIYHACIKAP