Protein Info for Shew_0197 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF05638: T6SS_HCP" amino acids 24 to 143 (120 residues), 105 bits, see alignment E=1.8e-34

Best Hits

Swiss-Prot: 53% identical to HCP1_PSEAE: Protein hcp1 (hcp1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11903, type VI secretion system secreted protein Hcp (inferred from 100% identity to slo:Shew_0197)

Predicted SEED Role

"Uncharacterized protein ImpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9C1 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Shew_0197 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MYKLAAMGLLALSSFTLNAATDMFLKIDGVDGESLDAQHRNEIDVLAWSWGASSDMRRTC
IQDISVTKYVDSASPQLLMNQMSHMQYPRATLTVRKAGGTPLEYIVIELRDVWVSSLSTG
GSGGEDRLTENITLNFEELKYQYTPQKADGSGGPAISATITSEKCR