Protein Info for Shew_0187 in Shewanella loihica PV-4
Annotation: Heme exporter protein D (CcmD) (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to CCMD_HAEIN: Heme exporter protein D (ccmD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K02196, heme exporter protein D (inferred from 100% identity to slo:Shew_0187)MetaCyc: 44% identical to cytochrome c maturation protein D (Escherichia coli K-12 substr. MG1655)
RXN-21407
Predicted SEED Role
"Cytochrome c-type biogenesis protein CcmD, interacts with CcmCE" in subsystem Biogenesis of c-type cytochromes
MetaCyc Pathways
- cytochrome c biogenesis (system I type) (8/11 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3Q9B1 at UniProt or InterPro
Protein Sequence (66 amino acids)
>Shew_0187 Heme exporter protein D (CcmD) (RefSeq) (Shewanella loihica PV-4) MQFDSLADFFNMGGYAFYVWLSYGITAFALGTLIVVSLRQKRKILTEISKKMQREERLKA NRSKEQ