Protein Info for Shew_0142 in Shewanella loihica PV-4

Annotation: biotin--protein ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 146 to 162 (17 residues), see Phobius details PF08279: HTH_11" amino acids 7 to 60 (54 residues), 56.9 bits, see alignment 2.4e-19 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 83 to 316 (234 residues), 209.3 bits, see alignment E=3.1e-66 PF03099: BPL_LplA_LipB" amino acids 86 to 208 (123 residues), 80.8 bits, see alignment E=1.3e-26 PF02237: BPL_C" amino acids 273 to 317 (45 residues), 42.3 bits, see alignment 8.9e-15

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to slo:Shew_0142)

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15) / Biotin operon repressor" in subsystem Biotin biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q966 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Shew_0142 biotin--protein ligase (RefSeq) (Shewanella loihica PV-4)
MHDQWARRRDIIRLLSQGHFVSGEALASELGISRAAVSKQVANLEEFGVDIYSVKGKGYK
LATPISLIDEAKLKTAIKNRCFYFNEINSTNGFLLEHVKDLSSGDICVAEYQSAGRGRRG
RQWVSPYGCHLYTSFYWQFSQGMAQAMGLSLVVGCSLVTVLRSLGVDGIGVKWPNDIYLN
HKKLAGILIEMSGQADSVCDLVIGIGINLSMSPAQADKIDQPWSDLSELTQLPDKTELMI
ALQQQLVTDLELFQRQGLKAFQSRWREADLFDGEPIKLLMGENSVEGICCGIDEQGAILL
KTEEGTKAFVGGEISMRPA