Protein Info for Shew_0128 in Shewanella loihica PV-4

Annotation: HAD family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00702: Hydrolase" amino acids 7 to 183 (177 residues), 68.3 bits, see alignment E=1.2e-22 PF13419: HAD_2" amino acids 10 to 184 (175 residues), 44.7 bits, see alignment E=1.5e-15 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 74 to 185 (112 residues), 46.3 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 50% identical to YRFG_SHIFL: GMP/IMP nucleotidase YrfG (yrfG) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to slo:Shew_0128)

MetaCyc: 50% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q952 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Shew_0128 HAD family hydrolase (RefSeq) (Shewanella loihica PV-4)
MFPWNKIDTVLLDMDGTLLDLHFDNHFWLSLVPQALCEQRQIPKADAQQLVESAYAKVFG
TLEWYCLEYWQQELGLDILALHHTLVDRIQLRQDSMPFLTALARHSKRRILVTNAHPHSL
ALKLEHTDLANGLDEMLSSHATGYPKEHPQFWRHLFNQYSLDPSRCLFIDDSEPILQAAK
KAGVGYQLGIKNPDSQQPHKQFADFPAIDDYHHLLLSLEQARLG