Protein Info for Shew_0125 in Shewanella loihica PV-4

Annotation: cytochrome c oxidase, subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details PF02790: COX2_TM" amino acids 21 to 102 (82 residues), 52.7 bits, see alignment E=7.5e-18 TIGR02866: cytochrome c oxidase, subunit II" amino acids 31 to 249 (219 residues), 186.5 bits, see alignment E=2.1e-59 PF00116: COX2" amino acids 117 to 239 (123 residues), 128.5 bits, see alignment E=2.5e-41 PF13442: Cytochrome_CBB3" amino acids 277 to 350 (74 residues), 41.8 bits, see alignment E=2.3e-14 amino acids 425 to 498 (74 residues), 39.4 bits, see alignment E=1.2e-13 PF00034: Cytochrom_C" amino acids 278 to 350 (73 residues), 32.3 bits, see alignment E=4.2e-11 amino acids 426 to 498 (73 residues), 31.4 bits, see alignment E=7.8e-11

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to slo:Shew_0125)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q949 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Shew_0125 cytochrome c oxidase, subunit II (RefSeq) (Shewanella loihica PV-4)
MKQVLCCLLALLFTPTILAADMPLNMTSGVTEISNKVFSLHMTILYICCAIGLVVFGVMI
YAIINHRRSKGAVAANFHESTKVEIAWTLVPFVILILMAIPATKTLIAMEDPSNADLTIK
ITGSQWKWHYSYFDQDISYYSLLATPREQIEGKETKGEHYLLEVDKPLVLPVNRKIRFLM
TSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGIYRGQCAELCGKDHGFMPIVVQVL
SEADFDNWIVEQEAQASAAAAEAQAALSKTLSKEELMAQGEQVYMARCAACHQPNGAGLP
GVFPSLIGSPIIKGPVADHLDVVLHGRSGTAMQAFAQQLTATEIAAVVTFERNAWGNDTG
DTVQAADVNQANSGASSGADTGADAAAEAVQSVPTPAADSSAAASSTAEDPQAPVLDDLT
MDELMAKGEQVYLGHCAACHQATGMGLPGAFPALKGSAIATGPVKNHLDIVLHGKPGTAM
QAFASQLTPQEIASVITFERNAWGNNTGDMVQATDVKQQGQ