Protein Info for Shew_0122 in Shewanella loihica PV-4

Annotation: cytochrome c oxidase, subunit III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF00510: COX3" amino acids 8 to 290 (283 residues), 171.7 bits, see alignment E=1.4e-54

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to slo:Shew_0122)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q946 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Shew_0122 cytochrome c oxidase, subunit III (RefSeq) (Shewanella loihica PV-4)
MTSKHEHYYVPAQSAWPIIGAFGLFLIAYGAGSYVQQLQTEQTSGGYILTAGIAVILYMV
FGWFRTVIGESMSGLYSKQMDRSFRQGMSWFIFSEVMFFAAFFGALLYARTIAVPWLGGA
SNNAMTHEVLWPNFQAVWPLVTTPDGTKTEAMGWTGLPLYNTIILLTSSVTLHFAHVSLE
KSKRTALTLWLGITILLGLAFLFLQAKEYAHAYQEMGLTLSSGVYGNTFFLLTGFHGMHV
TLGTIFLFVLFLRVLRGHFTPDKHFAFQAGSWYWHFVDVVWLCLFVFVYVL