Protein Info for Shew_0093 in Shewanella loihica PV-4

Annotation: molybdate ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 8 to 216 (209 residues), 235.8 bits, see alignment E=1.9e-74 PF00528: BPD_transp_1" amino acids 23 to 217 (195 residues), 68.5 bits, see alignment E=3.3e-23

Best Hits

Swiss-Prot: 40% identical to MODB_AZOVI: Molybdenum transport system permease protein ModB (modB) from Azotobacter vinelandii

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to slo:Shew_0093)

MetaCyc: 38% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q917 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Shew_0093 molybdate ABC transporter, inner membrane subunit (RefSeq) (Shewanella loihica PV-4)
MDWQALLLSIKLSCVTVLVLIPFAIWAGRFLAYRQFRGKSWLEALIMVPLVLPPTVIGYY
LLVGLGSQSWLGQTLEALLGQQLVFHFSGLVVASVLVNIPFAIQPIQRAFESVPEEVRDA
GACCGMSPAKVLFKIELPLVWPGVLTALVLCFSHVLGEFGVVLMMGGNIAGETKTIAISI
YDSVQAFDFAAAGQMSLLLLLFAITALALTTSLSRRLGGVSVSRRR