Protein Info for Shew_0091 in Shewanella loihica PV-4

Annotation: molybdopterin biosynthesis MoaE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 10 to 123 (114 residues), 138.7 bits, E=4.6e-45

Best Hits

Swiss-Prot: 58% identical to MOAE_ECOLI: Molybdopterin synthase catalytic subunit (moaE) from Escherichia coli (strain K12)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to slo:Shew_0091)

MetaCyc: 58% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

See A3Q915 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Shew_0091 molybdopterin biosynthesis MoaE (RefSeq) (Shewanella loihica PV-4)
MSQASDRVLVQTQDFSVPDEYARIAADDSDGAVVTFVGKVRDFNDGSAVTDLTLEHYPGM
TEAVLNQIAVEARERWPLTHVTIIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFL
KTKAPFWKLEAGDQGKNWVEAKDADEQAAKMWEKQ