Protein Info for Shew_0087 in Shewanella loihica PV-4

Name: moaA
Annotation: molybdenum cofactor biosynthesis protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 15 to 337 (323 residues), 347.4 bits, see alignment E=3.7e-108 PF04055: Radical_SAM" amino acids 28 to 189 (162 residues), 134.3 bits, see alignment E=7.2e-43 PF13353: Fer4_12" amino acids 33 to 133 (101 residues), 29 bits, see alignment E=1.9e-10 PF06463: Mob_synth_C" amino acids 194 to 320 (127 residues), 131.3 bits, see alignment E=3.2e-42

Best Hits

Swiss-Prot: 76% identical to MOAA_SHEDO: GTP 3',8-cyclase (moaA) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to slo:Shew_0087)

MetaCyc: 59% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q911 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Shew_0087 molybdenum cofactor biosynthesis protein A (RefSeq) (Shewanella loihica PV-4)
MTHLPLLGKVIMSQLQDNFGRRFHYLRMSVTDVCNFKCTYCLPDGYRPDGKPKFLDLNEI
ENLVGAFAEVGTQKIRITGGEPTLRKDFTDIVRIVADNDKIKTLATTTNGYRLEKHAKEW
FDAGLRRINVSVDSLDPRMFYQITGENKFDEVMRGVDAALEAGFERVKINAVLLKGLNDK
DLPRFLHWIKHTPIDLRFIELMETGLGREYFKAHHLAGADIKSQLVQDGWQLDQSAVDDG
PAQNFSHDDFKGRIGLIMPYEKNFCASCNRLRVSAKGKLHLCLFTEHGVDLRDLLQSHEQ
RAELIERLHGQLRAKKETHFLHDGITGVTQHLASIGG