Protein Info for Shew_0056 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 PF13237: Fer4_10" amino acids 198 to 237 (40 residues), 27.5 bits, see alignment 1.3e-09 amino acids 421 to 470 (50 residues), 26.3 bits, see alignment 3.2e-09 PF12838: Fer4_7" amino acids 199 to 240 (42 residues), 28.5 bits, see alignment 9.5e-10 PF12800: Fer4_4" amino acids 223 to 239 (17 residues), 11.2 bits, see alignment (E = 0.00025) amino acids 426 to 440 (15 residues), 13.3 bits, see alignment (E = 5.1e-05) amino acids 458 to 471 (14 residues), 14.9 bits, see alignment (E = 1.6e-05) PF00037: Fer4" amino acids 422 to 444 (23 residues), 25.2 bits, see alignment (E = 5.9e-09) amino acids 453 to 474 (22 residues), 23.8 bits, see alignment (E = 1.7e-08) PF13187: Fer4_9" amino acids 427 to 474 (48 residues), 31.5 bits, see alignment 8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0056)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8Y1 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Shew_0056 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSMHLETSDNLAHLKQVRQQVLGQTQILQNLIPPTVSYTTEGNVLIIGPEDLARLAADKL
ANMGQRAILANESITSQDEDHLEKVMNAAEDVESYYNKLIEIKGFLGQFQVKVEHDNGTA
DLSLVAIRKAHFDLILDLSQAPCINLEMLPPGYFYVGQDEAKLTDAIAQLPELIGEFDKP
RYVKVNSDICAHHRNGIDGCSRCLNFCPADAIASVDHKIEIDPYLCHGAGSCTNACPTGA
ISYDLPTPQALHSYLNKLVTRFRSAAQTAPVILFHDASLGASLIGDELPGAILPVELEEI
TVASMDHWMAALAWGARQILVLNTEATAPTLTQMLNGELKLANEILDEMGQPQRVSVIEA
KQIADLATLIEPSASWPMIVPGEFAATTKRETLYEAIDHLNSQAASTDACLSKSNIPYGK
VSVNTDNCTLCLSCVSTCPTQALTDGGEKPALYFVEQACVQCGLCESACPEKVISLTPQI
NFDATARQSRQTLNEEAPFECIRCGTPFATQSMVQRMLDVVGGHSAFSANTERLKMCSDC
RVKDMFEDILQDPEKQLR