Protein Info for Shew_0051 in Shewanella loihica PV-4

Annotation: cyclic nucleotide-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF00027: cNMP_binding" amino acids 37 to 119 (83 residues), 55.5 bits, see alignment E=9.1e-19 PF00571: CBS" amino acids 152 to 214 (63 residues), 31.7 bits, see alignment E=3.2e-11 amino acids 229 to 278 (50 residues), 37.5 bits, see alignment 4.9e-13 PF03445: DUF294" amino acids 305 to 442 (138 residues), 154.3 bits, see alignment E=3.6e-49 PF10335: DUF294_C" amino acids 479 to 622 (144 residues), 153.9 bits, see alignment E=5.4e-49

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to slo:Shew_0051)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8X6 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Shew_0051 cyclic nucleotide-binding protein (RefSeq) (Shewanella loihica PV-4)
MEAELNEIQNFLSQYPPFNALPDEVVAMVSHHVEIAYYRQDTPIIHFGDQIHDLYMVRSG
VVEVYRRKGELYNRLDSGDLFGQMGLLTNNKVRFPVKAIEDTLVYCIPEAIFQQLYDQYD
TFADFVEVEDSARLRQTVSNTSEQNDLTTSKVKTLLTRDAPVIHKGESIQQAAIMMAQEN
VSALLVIDPDVLEDEDGDTSPLLGIITDRDLCTRVVAEGIDPATELAGVVSTEVITLDHN
AYVYEAMLTMLRYNVHHLPVCKGRKPIGIIEATDIVRYESQNSLLLVSSIFQQQSLEELA
ALATQVKDSFVRLVNEDANSHMVGSAMSVIGRSFKQRILELAEEKLGPPPIPYCFLALGS
MGRDEQLIVTDQDNAIILDDDFDKAKHDDYFSQLANFVCDGLDSCGYSYCTGDIMATNPM
WRMTRKEWEACFADWIDDPNPKALLNASIFFDLDGVYGRLKWAEQLNGFIVRRARKNNRF
LACLARNALNRTPPLGFFKDFVMEKDGRHNNSINLKRRGTAPLADLIRVHALAVGSRARN
SFERLDDIIDANILPKGRGEDLRDAMEFISMVRIRHQALDVEQGIDPDNNIEPEHLSDFE
RRNLKDAFQILSNAQNFLKFRYNASNQFK